Rekombinante Proteine

Modifizierte oder manipulierte Proteine, die mit rekombinanter DNA kodiert werden und für eine Vielzahl von Zwecken geeignet sind, einschließlich der Modifizierung von Gensequenzen, der Massenproduktion von Proteinen und der Herstellung kommerzieller Produkte.

1 – 15 von 77,161 Ergebnisse

Invitrogen™ Human VCAM-1 Recombinant Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit

Invitrogen™ Human KIRREL3 (aa 670-768) Control Fragment Recombinant Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit

Invitrogen™ Human DNMT1 (aa 766-911) Control Fragment Recombinant Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit

Invitrogen™ Human PRG2 (aa 61-128) Control Fragment Recombinant Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit

Invitrogen™ Human DMAP1 (aa 242-338) Control Fragment Recombinant Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit

Invitrogen™ Human Tau (aa 298-380) Control Fragment Recombinant Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit

Abnova™ GST Protein

GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.

Preisgestaltung & Verfügbarkeit
Technische Daten

Zusammensetzung	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
Zielspeziesname	Human
Lagerungsbedingungen	Store at -80°C Aliquot to avoid repeated freezing and thawing
Sequenz	MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV
Zur Verwendung mit (Anwendung)	Antibody Production,Protein Array,ELISA,Western Blot
Qualitätskontrollen	12.5% SDS-PAGE Stained with Coomassie Blue
Zugriffsnummer	AAB37352
Quelle	Wheat Germ (in vitro)

Lagerungsbedingungen	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Rekombinant	Recombinant
pH-Bereich	8
Form	Solution
Spezies	Wheat Germ (in vitro)
Qualitätskontrollen	12.5% SDS-PAGE Stained with Coomassie Blue.
Zugriffsnummer	AAH33817
Proteinmarkierung	GST
Name	PSIP1 (Human) Recombinant Protein (P01)
Gensymbol	PSIP1
Zusammensetzung	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gebräuchliche Bezeichnung	PSIP1
Molekulargewicht	31.13
Kreuzreaktivität	Human
Vorbereitungsmethode	In vitro wheat germ expression system
Immunogen	MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
Zur Verwendung mit (Anwendung)	Antibody Production,Protein Array,ELISA,Western Blot
Reinigungsverfahren	Glutathione Sepharose 4 Fast Flow
Gen-Alias	DFS70/LEDGF/MGC74712/PAIP/PSIP2/p52/p75
Quelle	Wheat Germ (in vitro)
Gen-ID (Entrez)	11168

enQuireBio™ Recombinant Human EPOR Protein

A cDNA sequence encoding the EPOR was constructed and used to recombinantly synthesize the protein.

Preisgestaltung & Verfügbarkeit
Technische Daten

Gensymbol	EPOR
Kennzeichnung	Research Use Only
Kreuzreaktivität	Human
Puffer	EPOR protein solution (0.5 mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Sequenz	APPPNLPDPK FESKAALLAA RGPEELLCFT ERLEDLVCFW EEAASAGVGP GNYSFSYQLE DEPWKLCRLH QAPTARGAVR FWCSLPTADT SSFVPLELRV TAASGAPRYH RVIHINEVVL LDAPVGLVAR LADESGHVVL RWLPPPETPM TSHIRYEVDV SAGNGAGSVQ RVEILEGRTE CVLSNLRGRT RYTFAVRARM AEPSFGGFWS AWSEPVSLLT PSDLDPHHHH HH
Spezies	Baculovirus
Endotoxin-Konzentration	< 1.0 EU per ug protein as determined by the LAL method.
Produkttyp	Recombinant Protein
Proteinmarkierung	His
Biologische Aktivität	Measured by its ability to inhibit EPO dependent proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect less or equal to 70ng/ml.
Reinheits- oder Qualitätsgrad	Greater than 95.0% as determined by analysis by SDS-PAGE.
Name	EPOR Protein
Gen-ID (Entrez)	2057

Novus Biologicals™ Recombinant Protein A/G Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit

Novus Biologicals™ Recombinant Human CSK His Protein

Highly purified. Generating reliable and reproducible results.

Preisgestaltung & Verfügbarkeit
Technische Daten

Zusammensetzung	Phosphate buffered saline (pH 7.4) containing 20% glycerol, 1mM DTT
Lagerungsbedingungen	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Rekombinant	Recombinant
Gebräuchliche Bezeichnung	CSK
Molekulargewicht	TMW: 53.1kDa
Konjugat	Unconjugated
Zur Verwendung mit (Anwendung)	SDS-PAGE
Konzentration	0.5mg/mL
Gen-Alias	C-Src kinase, c-src tyrosine kinase, EC 2.7.10, EC 2.7.10.2, MGC117393, Protein-tyrosine kinase CYL, tyrosine-protein kinase CSK
Reinheits- oder Qualitätsgrad	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Gen-ID (Entrez)	1445

R&D Systems™ Recombinant Mouse Wnt-9a Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Preisgestaltung & Verfügbarkeit
Technische Daten

Lagerungsbedingungen	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Rekombinant	Recombinant
Molekulargewicht	37 kDa
Konjugat	Unconjugated
Menge	25 μg
Quelle	Chinese Hamster Ovary cell line,CHO-derived mouse Wnt-9a protein Tyr30-Gly365
Reinheits- oder Qualitätsgrad	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Name	Wnt-9a
Gen-ID (Entrez)	216795

R&D Systems™ Recombinant Human PPA1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Preisgestaltung & Verfügbarkeit

R&D Systems™ Recombinant S. cerevisiae PPA1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Preisgestaltung & Verfügbarkeit

R&D Systems™ Recombinant Human NF-L Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Preisgestaltung & Verfügbarkeit

Vorherige
1
2
3
4
5
6
...
5,145
Nächste

Rekombinante Proteine

Rekombinante Proteine

Invitrogen™ Human VCAM-1 Recombinant Protein

Invitrogen™ Human KIRREL3 (aa 670-768) Control Fragment Recombinant Protein

Invitrogen™ Human DNMT1 (aa 766-911) Control Fragment Recombinant Protein

Invitrogen™ Human PRG2 (aa 61-128) Control Fragment Recombinant Protein

Invitrogen™ Human DMAP1 (aa 242-338) Control Fragment Recombinant Protein

Invitrogen™ Human Tau (aa 298-380) Control Fragment Recombinant Protein

Abnova™ GST Protein

Abnova™ PSIP1 Recombinant Protein

enQuireBio™ Recombinant Human EPOR Protein

Novus Biologicals™ Recombinant Protein A/G Protein

Novus Biologicals™ Recombinant Human CSK His Protein

R&D Systems™ Recombinant Mouse Wnt-9a Protein

R&D Systems™ Recombinant Human PPA1 Protein

R&D Systems™ Recombinant S. cerevisiae PPA1 Protein

R&D Systems™ Recombinant Human NF-L Protein

Kürzlich angesehene Artikel ...Anzeigen

Gefilterte Suchergebnisse

Rekombinante Proteine

Rekombinante Proteine

Ausgewählte Filter

Ergebnisse verfeinern

Ergebnisse verfeinern

Gefilterte Suchergebnisse