Learn More
Invitrogen™ Human PRG2 (aa 61-128) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP97538
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83423 (PA5-83423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions. It is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases.
Spezifikation
P13727 | |
Blocking Assay, Control | |
5553 | |
100 μL | |
BMPG; bone marrow proteoglycan; bone-marrow proteoglycan; EMBP; Eosinophil granule major basic protein; eosinophil major basic protein; LPR3; major basic protein 1; MBP; MBP1; Mbp-1; mMBP; mMBP-1; natural killer cell activator; Pregnancy-associated major basic protein; PRG2; PRG-2; proMBP; Proteoglycan 2; proteoglycan 2 preproprotein; proteoglycan 2, bone marrow; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein); proteoglycan 2, pro eosinophil major basic protein | |
PRG2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PRG2 (aa 61-128) Control Fragment | |
RUO | |
PRG2 | |
Unconjugated | |
Recombinant | |
GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.