missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PSIP1 Recombinant Protein
371.00 CHF - 561.00 CHF
Spezifikation
| Zugriffsnummer | AAH33817 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
| Zusammensetzung | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gen-ID (Entrez) | 11168 |
| Molekulargewicht | 31.13 |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16196302
|
Abnova™
H00011168-P01.10ug |
10 μg |
371.00 CHF
10 Mikrogramm |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
16106312
|
Abnova™
H00011168-P01.25ug |
25 μg |
561.00 CHF
25 Mikrogramm |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
| AAH33817 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 31.13 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PSIP1 | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 11168 | |
| PSIP1 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET | |
| DFS70/LEDGF/MGC74712/PAIP/PSIP2/p52/p75 | |
| PSIP1 | |
| Wheat Germ (in vitro) | |
| GST |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ PSIP1 Recombinant Protein