missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DNMT1 (aa 766-911) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP101879
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants.
Spezifikation
P26358 | |
Blocking Assay, Control | |
1786 | |
100 μL | |
ADCADN; AIM; CXXC9; CXXC-type zinc finger protein 9; DNA (cytosine-5-)-methyltransferase 1; DNA (cytosine-5)-methyltransferase 1; DNA methyltransferase (cytosine-5) 1; DNA methyltransferase 1; DNA methyltransferase HsaI; DNA methyltransferase I; DNA methyltransferase MmuI; DNA MTase HsaI; DNA MTase MmuI; DNA MTase RnoIP; DNMT; Dnmt1; Dnmt1o; FLJ16293; HSN1E; m.HsaI; m.MmuI; m.RnoIP; MCMT; Met1; Met-1; MGC104992; MommeD2; MTase; Uim | |
DNMT1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human DNMT1 (aa 766-911) Control Fragment | |
RUO | |
DNMT1 | |
Unconjugated | |
Recombinant | |
IPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Produktvorschläge
Customers who viewed this item also viewed.
Viewing 1-4 of
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Invitrogen™ Human DNMT1 (aa 766-911) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur