Learn More
Invitrogen™ Human KIRREL3 (aa 670-768) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP103252
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63287 (PA5-63287. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the nephrin-like protein family. These proteins are expressed in fetal and adult brain, and also in podocytes of kidney glomeruli. The cytoplasmic domains of these proteins interact with the C-terminus of podocin, also expressed in the podocytes, cells involved in ensuring size- and charge-selective ultrafiltration. The protein encoded by this gene is a synaptic cell adhesion molecule with multiple extracellular immunoglobulin-like domains and a cytoplasmic PDZ domain-binding motif. Mutations in this gene are associated with several neurological and cognitive disorders. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Spezifikation
Q8IZU9 | |
Blocking Assay, Control | |
84623 | |
100 μL | |
1500010O20Rik; 2900036G11Rik; Kiaa1867; kin of IRRE like 3 (Drosophila); Kin of irregular chiasm-like protein 3; kin of IRRE-like protein 3; KIRRE; KIRREL3; membrane protein mKirre; mKIAA1867; mKirre; MRD4; NEPH2; nephrin-like 2; nephrin-like protein 2; PRO4502; Processed kin of IRRE-like protein 3; SST4; UNQ5923/PRO4502/PRO19814; x kin of IRRE like 3 | |
KIRREL3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human KIRREL3 (aa 670-768) Control Fragment | |
RUO | |
KIRREL3 | |
Unconjugated | |
Recombinant | |
PTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSR | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.