missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GST Protein
GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.
424.00 CHF - 645.00 CHF
Spezifikation
| Zugriffsnummer | AAB37352 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
| Zusammensetzung | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer |
| Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Quelle | Wheat Germ (in vitro) |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16141044
|
Abnova™
P0001.10ug |
10 μg |
424.00 CHF
10 Mikrogramm |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
16151044
|
Abnova™
P0001.25ug |
25 μg |
645.00 CHF
25 Mikrogramm |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Spezifikation
| AAB37352 | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer | |
| Wheat Germ (in vitro) | |
| MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C Aliquot to avoid repeated freezing and thawing | |
| Human |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ GST Protein