1
–
15
von
208
Ergebnisse

RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 750, Novus Biologicals™
Rabbit Monoclonal Antibody
Klon | rKRT10/6923 |
---|---|
Form | Purified |
Konjugat | Unconjugated |
Isotype | IgG1 κ |
Konzentration | 0.2 mg/ml |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4&drg;C. Do not freeze. |
Zusammensetzung | 10mM PBS with 0.05% BSA |
Klassifikation | Monoclonal |
Antigen | Cytokeratin 10 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fragment (around aa384-584) of human Cytokeratin 10 protein (exact sequence is proprietary) |
Zielspezies | Human |
Forschungsgebiet | Cell Biology, Cellular Markers |
Wirtsspezies | Mouse |
Reinigungsverfahren | Protein A or G purified |
Anwendungen | Immunohistochemistry (Paraffin) |
Verdünnung | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gen-Alias | BCIE, BIE, CK10, CK-10, cytokeratin 10, Cytokeratin-10, EHK, K10keratosis palmaris et plantaris, keratin 10, Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris), keratin, type I cytoskeletal 10, keratin-10, KPP |
Gen-ID (Entrez) | 3858 |
Bromodeoxyuridine/BrdU Antibody (BU-1) [Alexa Fluor™ 532], Novus Biologicals™
Mouse Monoclonal Antibody
Purine Nucleoside Phosphorylase/PNP Antibody (103), PerCP, Novus Biologicals™
Rabbit Monoclonal Antibody
Purine Nucleoside Phosphorylase/PNP Antibody (103), mFluor Violet 450 SE, Novus Biologicals™
Rabbit Monoclonal Antibody
Gensymbol | POLI |
---|---|
Zusammensetzung | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Lagerungsbedingungen | Store at -80°C. Avoid freeze-thaw cycles. |
Forschungskategorie | DNA Polymerases, DNA Repair |
Molekulargewicht | MolecularWeight-theroretical: 106.7 kDa |
Zur Verwendung mit (Anwendung) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
Gen-Alias | DNA polymerase iota, EC 2.7.7.7, Eta2, polymerase (DNA directed) iota, RAD30 homolog B, RAD30Bpolymerase (DNA-directed), iota, RAD3OB |
Protein | DNA Polymerase iota |
Reinheits- oder Qualitätsgrad | >80% by SDS-PAGE and Coomassie blue staining |
Gen-ID (Entrez) | 11201 |
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 350, Novus Biologicals™
Rabbit Monoclonal Antibody
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 405, Novus Biologicals™
Rabbit Monoclonal Antibody
Novus Biologicals™ alpha Satellite Repeat Primer
alpha SAT primer for PCR in chromatin precipitation
Inhalt und Lagerung | Store at –20°C. Avoid Free/Thaw Cycles |
---|---|
Zur Verwendung mit (Anwendung) | Chromatin-Immunpräzipitation |
Produkttyp | alpha Satellite Repeat Primer |
Form | Purified |
---|---|
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
Zusammensetzung | PBS (pH 7.3), 50% glycerol |
Klassifikation | Polyclonal |
Antigen | NCKAP1 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC |
Zielspezies | Human,Mouse,Rat |
Forschungsgebiet | Apoptosis |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Affinity purified |
Anwendungen | Western Blot |
Verdünnung | Western Blot 1:500-1:2000 |
Gen-Alias | FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1 |
Gen-ID (Entrez) | 10787 |
Form | Purified |
---|---|
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
Zusammensetzung | PBS with 50% glycerol, pH7.3. |
Klassifikation | Polyclonal |
Antigen | CYTB |
Regulatorischer Status | RUO |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CYTB (YP_003024038.1). RGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFL |
Zielspezies | Human,Mouse,Rat |
Forschungsgebiet | Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Affinity purified |
Anwendungen | Western Blot,Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Verdünnung | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin |
Gen-Alias | cytochrome b, MTCYB, MT-CYB mitochondrially encoded cytochrome b |
Gen-ID (Entrez) | 4519 |
Klon | TFF1/7891 |
---|---|
Form | Purified |
Konjugat | Unconjugated |
Isotype | IgG |
Konzentration | 0.2 mg/ml |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4&drg;C. Do not freeze. |
Zusammensetzung | 10mM PBS with 0.05% BSA |
Klassifikation | Monoclonal |
Antigen | TFF1/pS2 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fragment (around aa1-84) of human TFF1/pS2 protein (exact sequence is proprietary) |
Zielspezies | Human |
Forschungsgebiet | Breast Cancer, Cancer |
Wirtsspezies | Mouse |
Reinigungsverfahren | Protein A or G purified |
Anwendungen | Immunohistochemistry (Paraffin) |
Verdünnung | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gen-Alias | BCEIbreast cancer, estrogen-inducible sequence expressed in, Breast cancer estrogen-inducible protein, breast cancer estrogen-inducible sequence, D21S21, gastrointestinal trefoil protein pS2, hP1.A, HPS2, pNR-2, Polypeptide P1.A, Protein pS2, pS2, trefoil factor 1, trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A |
Gen-ID (Entrez) | 7031 |