UserName
Gensymbol | CLOCK |
---|---|
Zusammensetzung | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Lagerungsbedingungen | Store at -80°C. Avoid freeze-thaw cycles. |
Forschungskategorie | Cancer, Circadian Rhythm, Hypoxia, Neuroscience, Transcription Factors and Regulators, Vision |
Molekulargewicht | MolecularWeight-theroretical: 36.74 kDa |
Zur Verwendung mit (Anwendung) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
Gen-Alias | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
Protein | CLOCK |
Reinheits- oder Qualitätsgrad | >80% by SDS-PAGE and Coomassie blue staining |
Gen-ID (Entrez) | 9575 |
Used for AP, Array, ELISA, WB-Re
Kennzeichnung | RUO |
---|---|
Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Rekombinant | Recombinant |
Form | Liquid |
Spezies | Wheat Germ (in vitro) |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Zugriffsnummer | NP_004889 |
Proteinmarkierung | GST |
Name | CLOCK (Human) Recombinant Protein (Q01) |
Gensymbol | CLOCK |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gebräuchliche Bezeichnung | CLOCK |
Molekulargewicht | 36.74kDa |
Expressionssystem | wheat germ expression system |
Immunogen | PVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPIN |
Zur Verwendung mit (Anwendung) | Antibody Production,ELISA,Protein Array,Western Blot |
Gen-Alias | KAT13D/KIAA0334/bHLHe8 |
Gen-ID (Entrez) | 9575 |