missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TIMELESS Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP94979
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
The general transcription factor IIE (TFIIE) is part of the RNA polymerase II transcription initiation complex, recruiting TFIIH and being essential for promoter clearance by RNA polymerase II. TFIIE is a heterodimer (and sometimes heterotetramer) of alpha and beta subunits. The protein encoded by this gene represents the beta subunit of TFIIE.
Spezifikation
| Q9UNS1 | |
| Blocking Assay, Control | |
| 8914 | |
| 100 μL | |
| RUO | |
| TIMELESS | |
| Human | |
| FVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLQELYLANKDVEGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQR | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| TIMELESS | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| C77407; Debt69; hTIM; mTim; Protein timeless homolog; RGD:620939}; rTIM; rTLP; TIM; Tim1; timeless; timeless {ECO:0000312; timeless circadian clock; timeless circadian clock 1; timeless circadian regulator; timeless homolog; TIMELESS1; timeless-like protein; Tof1 homolog; unknown | |
| Unconjugated | |
| Recombinant | |
| E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur