missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NCKAP5 (aa 501-581) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP96205
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
NCKAP5 (NCK Associated Protein 5) is a Protein Coding gene. An important paralog of this gene isNCKAP5L.Spezifikation
O14513 | |
Blocking Assay, Control | |
344148 | |
100 μL | |
RUO | |
NCKAP5 | |
Human | |
SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
NCKAP5 | |
-20° C, Avoid Freeze/Thaw Cycles | |
8430408F21; D130011D22Rik; E030049G20Rik; ERIH; ERIH1; Erih2; Gm1548; NAP5; NAP-5; NCK associated protein 5; NCKAP5; NCK-associated protein 5; Peripheral clock protein; peripheral clock protein 2; RGD1564507 | |
Unconjugated | |
Recombinant | |
E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur