missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PASD1 (aa 322-464) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP92228
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
This gene encodes a protein that is thought to function as a transcription factor. The protein is a cancer-associated antigen that can stimulate autologous T-cell responses, and it is therefore considered to be a potential immunotherapeutic target for the treatment of various hematopoietic malignancies, including diffuse large B-cell lymphoma.Spezifikation
Q8IV76 | |
Blocking Assay, Control | |
139135 | |
100 μL | |
RUO | |
PASD1 | |
Human | |
QQDPENPVAPLDQAGLMDPVDPEDSVDLGAAGASAQPLQPSSPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVVIPDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSL | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
PASD1 | |
-20° C, Avoid Freeze/Thaw Cycles | |
Cancer/testis antigen 63; circadian clock protein PASD1; CT63; Gm1141; OXTES1; OX-TES-1; PAS domain containing 1; PAS domain-containing protein 1; PASD1; predicted gene 1141 | |
Unconjugated | |
Recombinant | |
E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur