1
–
15
von
208
Ergebnisse

Klon | 2906A |
---|---|
Rekonstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Form | Purified |
Gen-Zugriffsnummer | Q08554 |
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Zusammensetzung | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Klassifikation | Monoclonal |
Antigen | Desmocollin-1 |
Regulatorischer Status | RUO |
Immunogen | Mouse myeloma cell line, NS0-derived human Desmocollin-1, Arg135-Asn686, Accession # Q08554 |
Zielspezies | Human |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Protein A or G purified from hybridoma culture supernatant |
Anwendungen | Immunohistochemistry |
Verdünnung | Immunohistochemistry 3-25 ug/mL |
Gen-Alias | cadherin family member 1, CDHF1, desmocollin 1, desmocollin-1, Desmocollin1, desmosomal glycoprotein 2/3, DG2/DG3, DSC1 |
Gen-ID (Entrez) | 1823 |
Klon | 2771C |
---|---|
Rekonstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Form | Purified |
Gen-Zugriffsnummer | P14222 |
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
Zusammensetzung | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. |
Klassifikation | Monoclonal |
Antigen | Perforin |
Regulatorischer Status | RUO |
Immunogen | Chinese Hamster Ovary cell line CHO-derived human Perforin, Pro22-Trp555, Accession # P14222 |
Zielspezies | Human |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Protein A or G purified from cell culture supernatant |
Anwendungen | Immunohistochemistry |
Verdünnung | Immunohistochemistry 5-25 ug/mL |
Gen-Alias | Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFP, PFPcytolysin, PRF1 |
Gen-ID (Entrez) | 5551 |
Bromodeoxyuridine/BrdU Antibody (SPM166), Janelia Fluor™ 549, Novus Biologicals™
Mouse Monoclonal Antibody
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), PerCP, Novus Biologicals™
Rabbit Monoclonal Antibody
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 350, Novus Biologicals™
Rabbit Monoclonal Antibody
Klon | rKRT10/6923 |
---|---|
Form | Purified |
Konjugat | Unconjugated |
Isotype | IgG1 κ |
Konzentration | 0.2 mg/ml |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4&drg;C. Do not freeze. |
Zusammensetzung | 10mM PBS with 0.05% BSA |
Klassifikation | Monoclonal |
Antigen | Cytokeratin 10 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fragment (around aa384-584) of human Cytokeratin 10 protein (exact sequence is proprietary) |
Zielspezies | Human |
Forschungsgebiet | Cell Biology, Cellular Markers |
Wirtsspezies | Mouse |
Reinigungsverfahren | Protein A or G purified |
Anwendungen | Immunohistochemistry (Paraffin) |
Verdünnung | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gen-Alias | BCIE, BIE, CK10, CK-10, cytokeratin 10, Cytokeratin-10, EHK, K10keratosis palmaris et plantaris, keratin 10, Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris), keratin, type I cytoskeletal 10, keratin-10, KPP |
Gen-ID (Entrez) | 3858 |
R&D Systems™ H/M Pluripotent Stem Cell Multi-Color Flow Cytometry Kit
For single-step staining of human/mouse pluripotent stem cells (h/mPSCs) (1-7)
RNA Polymerase II/POLR2A Antibody (POLR2A/9089R), Alexa Fluor™ 750, Novus Biologicals™
Rabbit Monoclonal Antibody
Form | Purified |
---|---|
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
Zusammensetzung | PBS (pH 7.3), 50% glycerol |
Klassifikation | Polyclonal |
Antigen | NCKAP1 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC |
Zielspezies | Human,Mouse,Rat |
Forschungsgebiet | Apoptosis |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Affinity purified |
Anwendungen | Western Blot |
Verdünnung | Western Blot 1:500-1:2000 |
Gen-Alias | FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1 |
Gen-ID (Entrez) | 10787 |
Bromodeoxyuridine/BrdU Antibody (BU-1) [Alexa Fluor™ 532], Novus Biologicals™
Mouse Monoclonal Antibody
Klon | TFF1/7891 |
---|---|
Form | Purified |
Konjugat | Unconjugated |
Isotype | IgG |
Konzentration | 0.2 mg/ml |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4&drg;C. Do not freeze. |
Zusammensetzung | 10mM PBS with 0.05% BSA |
Klassifikation | Monoclonal |
Antigen | TFF1/pS2 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fragment (around aa1-84) of human TFF1/pS2 protein (exact sequence is proprietary) |
Zielspezies | Human |
Forschungsgebiet | Breast Cancer, Cancer |
Wirtsspezies | Mouse |
Reinigungsverfahren | Protein A or G purified |
Anwendungen | Immunohistochemistry (Paraffin) |
Verdünnung | Immunohistochemistry-Paraffin 1-2 μg/mL |
Gen-Alias | BCEIbreast cancer, estrogen-inducible sequence expressed in, Breast cancer estrogen-inducible protein, breast cancer estrogen-inducible sequence, D21S21, gastrointestinal trefoil protein pS2, hP1.A, HPS2, pNR-2, Polypeptide P1.A, Protein pS2, pS2, trefoil factor 1, trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A |
Gen-ID (Entrez) | 7031 |
Purine Nucleoside Phosphorylase/PNP Antibody (103), PerCP, Novus Biologicals™
Rabbit Monoclonal Antibody