missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
For use in research applications
Marke: Novus Biologicals™ NBP2-29331-5MG
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung

Spezifikation
Human, Mouse | |
Inhibition of TIRAP binding to TLR2 or TLR4 | |
5 mg | |
3701.4 | |
Lyophilisiert |
TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361. | |
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
TIRAP (TLR2 and TLR4) Inhibitor Peptide Set | |
TLR2, TLR4 |
Produktvorschläge
Customers who viewed this item also viewed.
Viewing 1-5 of 11
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set > 5mg
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur