Learn More
Invitrogen™ Human TLR10 (aa 23-100) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP109112
Benachrichtigungen:
Um den Rabatt von 33.33% zu erhalten, müssen Kunden drei Einheiten desselben Produkts zum Listenpreis in einer einzigen Bestellung kaufen. Es gibt keine Begrenzung für die Anzahl von 3er Sets, die Kunden kaufen können. PCODE: 24111
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139881 (PA5-139881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is most highly expressed in lymphoid tissues such as spleen, lymph node, thymus, and tonsil. Its exact function is not known. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Spezifikation
Q9BXR5 | |
Blocking Assay, Control | |
81793 | |
100 μL | |
CD290; MGC104967; MGC126398; MGC126399; TLR10; toll like receptor 10; toll-like receptor 10; UNQ315/PRO358 | |
TLR10 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TLR10 (aa 23-100) Control Fragment | |
RUO | |
TLR10 | |
Unconjugated | |
Recombinant | |
ELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRY | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.