Invitrogen™ Human C6orf211 (aa 259-378) Control Fragment Recombinant Protein

Recombinant Protein

Marke: Invitrogen™ RP102000

Artikelnummer. 30209751

254.00 CHF / 100 Mikroliter

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52211 (PA5-52211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARMT1 gene ontology annotations related to this gene include protein carboxyl O-methyltransferase activity.

Spezifikation

Zugriffsnummer	Q9H993
Zur Verwendung mit (Anwendung)	Blocking Assay, Control
Gen-ID (Entrez)	79624
Menge	100 μL
Gen-Alias	Acidic residue methyltransferase 1; ARMT1; C6orf211; Damage-control phosphatase ARMT1; Protein-glutamate O-methyltransferase; Sugar phosphate phosphatase ARMT1; UPF0364 protein C6orf211
Gensymbol	ARMT1
Spezies	Human
Proteinmarkierung	His-ABP-tag
Inhalt und Lagerung	-20°C, Avoid Freeze/Thaw Cycles
Form	Liquid

Konzentration	≥5.0 mg/mL
Zusammensetzung	1 M urea, PBS with no preservative; pH 7.4
Name	Human C6orf211 (aa 259-378) Control Fragment
Kennzeichnung	RUO
Gebräuchliche Bezeichnung	C6orf211
Konjugat	Unconjugated
Rekombinant	Recombinant
Sequenz	LVTDLILADFLLSSELATEVHFYGKTIPWFVSDTTIHDFNWLIEQVKHSNHKWMSKCGADWEEYIKMGKWVYHNHIFWTLPHEYCAMPQVAPDLYAELQKAHLILFKGDLNYRKLTGDRK
Expressionssystem	E. coli
Reinheits- oder Qualitätsgrad	>80% by SDS-PAGE and Coomassie blue staining

Produktvorschläge

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

287.00 CHF / 500 Milliliter
Catalog No. 13464189

Thermo Scientific ™ Pierce ™ Trypsin/Lys-C Pr Thermo Scientific ™ Pierce ™ Trypsin/Lys-C Pr

182.00 CHF / 5 Stück
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ Ultra TMB-ELISA Thermo Scientific ™ 1-Step ™ Ultra TMB-ELISA

389.00 CHF / 250 Milliliter
Catalog No. 11560626

Gibco ™ Trypsin-EDTA (0,25%), phenolrot Gibco ™ Trypsin-EDTA (0,25%), phenolrot

46.78 CHF / 100 Milliliter
Catalog No. 11548876

Gibco ™ Penicillin-Streptomycin (10.000 U/ml) Gibco ™ Penicillin-Streptomycin (10.000 U/ml)

63.25 CHF / 100 Milliliter
Catalog No. 10729174

Invitrogen ™ Goat anti-Rabbit IgG (H+L) Cross- Invitrogen ™ Goat anti-Rabbit IgG (H+L) Cross-

384.00 CHF / 500 Mikroliter
Catalog No. 11514270

Invitrogen Trenbolone Polyclonal Antibody, Invi Invitrogen Trenbolone Polyclonal Antibody, Invi

1102.00 CHF / 100 Mikroliter
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

256.00 CHF / 100 Mikrogramm
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

96.50 CHF / 100 Mikrogramm
Catalog No. 10533084

Gibco ™ Human EGF Recombinant Protein Gibco ™ Human EGF Recombinant Protein

430.00 CHF / 1 Stück

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Invitrogen™ Human C6orf211 (aa 259-378) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Invitrogen™ Human C6orf211 (aa 259-378) Control Fragment Recombinant Protein

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Sonderangebote

Kürzlich angesehene Artikel ...Anzeigen