missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Met-enkephalin Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP1-90944PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PENK. The Met-enkephalin Recombinant Protein Antigen is derived from E. coli. The Met-enkephalin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-90944. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Spezifikation
| 5179 | |
| Chromatography | |
| Unmarkiert | |
| ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEE |
| Human | |
| PENK | |
| 32kDa |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Novus Biologicals™ Met-enkephalin Recombinant Protein Antigen > 0.1mL
Nur für Forschungszwecke
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
