missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Met-enkephalin Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP1-90944PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PENK. The Met-enkephalin Recombinant Protein Antigen is derived from E. coli. The Met-enkephalin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-90944. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Spezifikation
| 5179 | |
| Chromatography | |
| Unmarkiert | |
| ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEE |
| Human | |
| PENK | |
| 32kDa |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Nur für Forschungszwecke
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur