Learn More
Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP91392
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64867 (PA5-64867, PA5-51512 (PA5-51512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The function of this protein remains unknown.
Spezifikation
Q9Y3I0 | |
Blocking Assay, Control | |
51493 | |
100 μL | |
3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; ankyrin repeat domain 54; C22orf28; C5H22orf28; D10Wsu52e; DJ149A16.6; FAAP; focal adhesion-associated protein; HAMAP-Rule:MF_03144}; HSPC117; hypothetical protein HSPC117; hypothetical protein LOC406376; hypothetical protein LOC525106; P55; RNA 2',3'-cyclic phosphate and 5'-OH ligase; RNA-splicing ligase RtcB homolog; RTCB; tRNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog {ECO:0000255; zgc:76871 | |
Rtcb | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RTCB (aa 340-499) Control Fragment | |
RUO | |
RTCB | |
Unconjugated | |
Recombinant | |
PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.