missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CD177 Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP109641
Benachrichtigungen:
Um den Rabatt von 33.33% zu erhalten, müssen Kunden drei Einheiten desselben Produkts zum Listenpreis in einer einzigen Bestellung kaufen. Es gibt keine Begrenzung für die Anzahl von 3er Sets, die Kunden kaufen können. PCODE: 24111
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CD177 (NB1/HNA-2a and PRV-1 form) is a GPI-anchored glycoprotein present mainly on neutrophils. Its plasma membrane expression is increased during pregnancy and and inflammation or after G-CSF application. Ligand of CD177 has been identified as CD31 (PECAM-1). CD177 participates in neutrophil transmigration and seems to be also a pro-proliferative molecule. The antibodies against CD177 can be involved in neonatal alloimmune neutropenia (NAN).
Spezifikation
| Q8N6Q3 | |
| Blocking Assay, Control | |
| 57126 | |
| 100 μL | |
| 1190003K14Rik; CD177; CD177 antigen; CD177 molecule; cell surface receptor; HNA2A; HNA-2 A; Human neutrophil alloantigen 2 A; NB1; NB1 glycoprotein; NB1 GP; Pdp3; Polycythemia rubra vera protein 1; PRV1; PRV-1; RGD1562941; UNQ595/PRO1181 | |
| CD177 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CD177 Control Fragment | |
| RUO | |
| CD177 | |
| Unconjugated | |
| Recombinant | |
| GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Invitrogen™ Human CD177 Control Fragment Recombinant Protein > 100 μL; Unlabeled
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
