missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ HGFR/c-MET Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP2-55719PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HGF R/c-MET. Source: E.coli Amino Acid Sequence: SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN The HGFR/c-MET Recombinant Protein Antigen is derived from E. coli. The HGFR/c-MET Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Spezifikation
| 4233 | |
| HGFR/c-MET | |
| PBS and 1M Urea, pH 7.4. | |
| AUTS9, c-Met, EC 2.7.10, EC 2.7.10.1, hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, HGFR, Met (c-Met), met proto-oncogene (hepatocyte growth factor receptor), met proto-oncogene tyrosine kinase, oncogene MET, Proto-oncogene c-Met, RCCP | |
| Unmarkiert | |
| 100 μl | |
| E.Coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| MET | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52038. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Nur für Forschungszwecke
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur