missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ HGFR/c-MET Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP2-55719PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HGF R/c-MET. Source: E.coli Amino Acid Sequence: SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN The HGFR/c-MET Recombinant Protein Antigen is derived from E. coli. The HGFR/c-MET Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spezifikation
| 4233 | |
| HGFR/c-MET | |
| PBS and 1M Urea, pH 7.4. | |
| AUTS9, c-Met, EC 2.7.10, EC 2.7.10.1, hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, HGFR, Met (c-Met), met proto-oncogene (hepatocyte growth factor receptor), met proto-oncogene tyrosine kinase, oncogene MET, Proto-oncogene c-Met, RCCP | |
| Unmarkiert | |
| 100 μl | |
| E.Coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| MET | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52038. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Novus Biologicals™ HGFR/c-MET Recombinant Protein Antigen > Quantity: 100μL
Nur für Forschungszwecke
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
