missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GST Protein
GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.
Marke: Abnova™ P0001.25ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Spezifikation
AAB37352 | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer | |
25 μg | |
Store at -80°C Aliquot to avoid repeated freezing and thawing | |
Human |
Antibody Production, Protein Array, ELISA, Western Blot | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
Wheat Germ (in vitro) | |
MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ GST Protein > 25 ug
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur