missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Renin R Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-94053-0.02ml
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Renin R Polyclonal antibody specifically detects Renin R in Human, Mouse, Rat samples. It is validated for Western Blot
Spezifikation
Renin R | |
Polyclonal | |
Western Blot 1:500-1:2000 | |
APT6M8-9, ATP6M8-9MRXE, ATPase H(+)-transporting lysosomal accessory protein 2, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase, H+ transporting, lysosomal accessory protein 2, ATPase, H+ transporting, lysosomal interacting protein 2, CAPER, ELDF10, Embryonic liver differentiation factor 10, ER-localized type I transmembrane adaptor, H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9, M8-9, MGC99577, MSTP009, N14F, renin receptor, vacuolar proton ATP synthase membrane sector associated protein M8-9, V-ATPase M8.9 subunit, XMRE | |
Recombinant fusion protein containing a sequence corresponding to amino acids 251-350 of human ATP6AP2 (NP_005756.2). MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD | |
0.02 mL | |
Cancer, Endocrinology, Signal Transduction | |
10159 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS (pH 7.3), 50% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Renin R Antibody - BSA Free, Novus Biologicals™ > 0.02 mL; Unconjugated
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur