missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ PML Protein Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP1-87783PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PML. The PML Protein Recombinant Protein Antigen is derived from E. coli. The PML Protein Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-87783. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Spezifikation
| 5371 | |
| Chromatography | |
| 0.5mg/mL | |
| PBS and 1M Urea, pH 7.4. | |
| PML | |
| 32kDa | |
| 0.1 mL | |
| E.Coli | |
| ISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLP |
| Human | |
| >80% | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| Unmarkiert | |
| PML Protein | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87783. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Novus Biologicals™ PML Protein Recombinant Protein Antigen > 0.1mL
Nur für Forschungszwecke
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
