missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Ocular development associated gene Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP2-57351PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ocular development associated gene. Source: E.coli Amino Acid Sequence: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR The Ocular development associated gene Recombinant Protein Antigen is derived from E. coli. The Ocular development associated gene Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spezifikation
| 57798 | |
| Ocular development associated gene Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| FLJ22489, GATA zinc finger domain containing 1, GATA zinc finger domain-containing protein 1, ocular development associated, Ocular development-associated gene protein, ODAGFLJ40695, RG083M05.2 | |
| Unmarkiert | |
| 100 μl | |
| E. coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| GATAD1 | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53377. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Novus Biologicals™ Ocular development associated gene Recombinant Protein Antigen > Quantity: 100μg
Nur für Forschungszwecke.
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur