missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARCH8. Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Bio-Techne NBP3-09974-100UL
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
44263 Polyclonal specifically detects 44263 in Human samples. It is validated for Western Blot.
Spezifikation
MARCH8. | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Cellular modulator of immune recognition, EC 6.3.2, EC 6.3.2.-, MARCH-VIIIcellular modulator of immune recognition, membrane-associated ring finger (C3HC4) 8, Membrane-associated RING finger protein 8, Membrane-associated RING-CH protein VIII, MIR, RING finger protein 178 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MARH8. Peptide sequence MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS | |
100 μg | |
Zinc Finger | |
220972 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
MARCH8. Rabbit anti-Human, Polyclonal, Novus Biologicals™ > 100 μg; Unconjugated
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur