Learn More
Invitrogen™ Human CDK11A (aa 688-765) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP105663
Benachrichtigungen:
Um den Rabatt von 33.33% zu erhalten, müssen Kunden drei Einheiten desselben Produkts zum Listenpreis in einer einzigen Bestellung kaufen. Es gibt keine Begrenzung für die Anzahl von 3er Sets, die Kunden kaufen können. PCODE: 24111
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84929 (PA5-84929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The PITSLRE beta1 protein, a distantly related member of the Cdk family of protein kinases, induces apoptosis after low levels of ectopic expression. Apoptosis, or programmed cell death, is similarly induced by ectopic expression of an amino terminal deletion mutant retaining the catalytic and carboxyterminal domains of PITSLRE beta1, but not by other mutants lacking Histone H1 kinase activity or by other Cdk family members. The terminology for the ten isoforms of the PITSLRE subfamily of proteins is based on the conserved PSTAIRE box region of Cdc2 p34. Depending on which of the PITSLRE genes produce the protein, the cDNA and protein are designated alpha, beta or gamma (i.e., PITSLRE A gene, alpha; PITSLRE B gene, beta and PITSLRE C gene, gamma). Some of the isoforms such as PITSLRE alpha1 (T cells) and PITSLRE beta1 (B cells and brain), are expressed in specific cell types, while others are expressed ubiquitously.
Spezifikation
Q9UQ88 | |
Blocking Assay, Control | |
728642 | |
100 μL | |
CDC2L2; CDC2L3; CDK11 p110; CDK11 p46; CDK11 p58; CDK11A; CDK11-p110; CDK11-p46; CDK11-p58; cell division cycle 2-like 2 (PITSLRE proteins); cell division cycle 2-like protein kinase 2; Cell division protein kinase 11 A; cyclin dependent kinase 11 A; cyclin-dependent kinase 11 A; Galactosyltransferase-associated protein kinase p58/GTA; p58GTA; PITSLRE; PITSLRE B; PITSLRE protein kinase beta; PITSLRE serine/threonine-protein kinase CDC2L2; PITSLREB | |
CDK11A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CDK11A (aa 688-765) Control Fragment | |
RUO | |
CDK11A | |
Unconjugated | |
Recombinant | |
MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.