missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FFAR4/GPR120 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-89739-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
FFAR4/GPR120 Polyclonal specifically detects FFAR4/GPR120 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
FFAR4/GPR120 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20 | |
Q5NUL3 | |
FFAR4 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FRVVPQRLPGADQEISICTLIWPTIPGEISWDV | |
25 μL | |
GPCR | |
338557 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
G protein-coupled receptor 120, G protein-coupled receptor 129, G protein-coupled receptor PGR4, GPR120, GPR129, G-protein coupled receptor 120, G-protein coupled receptor 129, G-protein coupled receptor GT01, G-protein coupled receptor PGR4, G-protein-coupled receptor GT01, GT01, MGC119984, omega-3 fatty acid receptor 1, PGR4DKFZp686F0824 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
FFAR4/GPR120 Antibody, Novus Biologicals™ > 25 μL; Unlabeled
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur