missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALAD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Bio-Techne NBP1-89157
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ALAD Polyclonal specifically detects ALAD in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| ALAD | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 | |
| P13716 | |
| ALAD | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYA | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ALADHEC 4.2.1.24, aminolevulinate dehydratase, aminolevulinate, delta-, dehydratase, delta-aminolevulinic acid dehydratase, PBGSMGC5057, Porphobilinogen synthase | |
| Rabbit | |
| 36 kDa | |
| 0.1 mL | |
| Proteases & Other Enzymes | |
| 210 | |
| Human, Mouse, Rat | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
ALAD Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur