missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Serine racemase Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP2-58903PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serine racemase. Source: E.coli Amino Acid Sequence: QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ The Serine racemase Recombinant Protein Antigen is derived from E. coli. The Serine racemase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Spezifikation
| 63826 | |
| Serine racemase Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| D-serine ammonia-lyase, D-serine dehydratase, EC 4.3.1.17, EC 4.3.1.18, EC 5.1.1.18, ILV1, ISO1, L-serine ammonia-lyase, L-serine dehydratase, serine racemase | |
| Unmarkiert | |
| 100 μl | |
| E. coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| SRR | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51059. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Nur für Forschungszwecke.