missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Serine Dehydratase Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP1-87070PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serine Dehydratase. The Serine Dehydratase Recombinant Protein Antigen is derived from E. coli. The Serine Dehydratase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-87070. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Spezifikation
51119 | |
Chromatography | |
0.5mg/mL | |
PBS and 1M Urea, pH 7.4. | |
SBDS | |
26kDa | |
0.1mL | |
E.Coli | |
PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE |
Human | |
>80% | |
Store at -20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
Unmarkiert | |
Shwachman Bodian-Diamond syndrome | |
RUO | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87070. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Nur für Forschungszwecke