missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ RPL39L Recombinant Protein
371.00 CHF - 561.00 CHF
Spezifikation
Zugriffsnummer | AAH12328 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
Zusammensetzung | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gen-ID (Entrez) | 116832 |
Molekulargewicht | 31.35 |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
16127363
|
Abnova™
H00116832-P01.10ug |
10 μg |
371.00 CHF
10 Mikrogramm |
Verfügbar ab: 19-02-2025
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
16137363
|
Abnova™
H00116832-P01.25ug |
25 μg |
561.00 CHF
25 Mikrogramm |
Verfügbar ab: 19-02-2025
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
AAH12328 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
31.35 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
RPL39L | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
116832 | |
RPL39L (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL | |
RPL39L1 | |
RPL39L | |
Wheat Germ (in vitro) | |
GST |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts