missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant other Pramlintide Protein
A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.
131.00 CHF - 725.00 CHF
Spezifikation
| Name | Pramlintide Protein |
|---|---|
| Kennzeichnung | Research Use Only |
| Endotoxin-Konzentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
| Produkttyp | Recombinant Protein |
| Kreuzreaktivität | Other |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
15952599
|
enQuireBio™
QP13132-1mg |
1 mg |
131.00 CHF
1 Milligramm |
Verfügbar ab: 11-12-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
15972599
|
enQuireBio™
QP13132-5mg |
5 mg |
203.00 CHF
5 Milligramm |
Verfügbar ab: 11-12-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
15962599
|
enQuireBio™
QP13132-25mg |
25 mg |
725.00 CHF
25 Milligramm |
Verfügbar ab: 11-12-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Spezifikation
| Pramlintide Protein | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Other | |
| Untagged | |
| The protein was lyophilized with no additives. |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 | |
| Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |