missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPAR gamma/NR1C3. Source: E.coli Amino Acid Sequence: DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC The PPAR gamma/NR1C3 Recombinant Protein Antigen is derived from E. coli. The PPAR gamma/NR1C3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Spezifikation
Spezifikation
Gene ID (Entrez) | 5468 |
Reinigungsverfahren | >80% by SDS-PAGE and Coomassie blue staining |
Gebräuchliche Bezeichnung | PPAR gamma/NR1C3 Recombinant Protein Antigen |
Inhalt und Lagerung | Store at −20°C. Avoid freeze-thaw cycles |
Zusammensetzung | PBS and 1M Urea, pH 7.4 |
Zur Verwendung mit (Anwendung) | Blocking/Neutralizing, Control |
Gen-Alias | CIMT1, NR1C3GLM1, Nuclear receptor subfamily 1 group C member 3, peroxisome proliferator-activated receptor gamma, peroxisome proliferator-activated receptor gamma 1, PPAR gamma, PPARG1peroxisome proliferative activated receptor, gamma, PPARG2PPARgamma, P |
Gensymbol | PPARG |
Markertyp | Unmarkiert |
Produkttyp | Recombinant Protein Antigen |
Mehr anzeigen |
Nur für Forschungszwecke.
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Novus Biologicals™ PPAR gamma/NR1C3 Recombinant Protein Antigen >
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur