missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PLEKHA6 Recombinant Protein
Marke: Abnova™ H00022874-P01.10ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
AAH10522.1 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
29.4 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 μg | |
MHPRWAARLPLFISLLERADSVTAAYAKQH | |
KIAA0969/MGC176733/PEPP3 | |
PLEKHA6 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
22874 | |
PLEKHA6 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PLEKHA6 | |
Human | |
Recombinant | |
Solution |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur