missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Cytochrome C1 (aa 181-322) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP99401
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.Spezifikation
P08574 | |
Blocking Assay, Control | |
1537 | |
100 μL | |
RUO | |
CYC1 | |
Human | |
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYR | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Cytochrome C1 | |
-20° C, Avoid Freeze/Thaw Cycles | |
2610002H19Rik; AA408921; Complex III subunit 4; complex III subunit IV; Cyc1; Cytochrome b-c1 complex subunit 4; cytochrome c1; cytochrome c-1; cytochrome c1, heme protein, mitochondrial; MC3DN6; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; UQCR4 | |
Unconjugated | |
Recombinant | |
E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur