missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Cytochrome B5 Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP103776
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Cytochrome b5 is a membrane-bound member of the cytochrome b family. A heme protein that functions as an electron carrier for many membrane-bound oxygenases, cytochrome b5 possesses two heme groups, which are not covalently attached to the protein. Two isoforms of cytochrome b5, a microsomal membrane-bound form and a cytoplasmic form, are produced by alternative splicing. Mutations in cytochrome b5 are associated with Leber's hereditary optic neuropathy and with myopathy.Spezifikation
P00167 | |
Blocking Assay, Control | |
1528 | |
100 μL | |
RUO | |
CYB5A | |
Human | |
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Cytochrome B5 | |
-20° C, Avoid Freeze/Thaw Cycles | |
0610009N12Rik; Cyb5; CYB5A; cytochrome b5; cytochrome b-5; cytochrome b5 type A; cytochrome b5 type A (microsomal); MCB5; Microsomal cytochrome b5 type A; type 1 cyt-b5 | |
Unconjugated | |
Recombinant | |
E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur