missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Chromogranin C (aa 438-580) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP89936
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown.
Spezifikation
| P13521 | |
| Blocking Assay, Control | |
| 7857 | |
| 100 μL | |
| RUO | |
| SCG2 | |
| Human | |
| NLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTP | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| Chromogranin C | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| Chcg; Chgc; Chromogranin C (Secretogranin II); chromogranin-C; EM66; Manserin; SCG2; Scg-2; secretogranin 2; secretogranin II; secretogranin II (chromogranin C); secretogranin-2; Secretoneurin; SgII; SN | |
| Unconjugated | |
| Recombinant | |
| E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur