missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Chromogranin B (aa 504-626) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP89888
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Chromogranin B is a tyrosine sulfated secretory protein found in a wide variety of peptidergic endocrine cells. Chromogranin functions as a neuroendocrine secretory granule protein which may be the precursor for other biologically active peptides.Spezifikation
P05060 | |
Blocking Assay, Control | |
1114 | |
100 μL | |
RUO | |
Chgb | |
Human | |
KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDS | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Chromogranin B | |
-20° C, Avoid Freeze/Thaw Cycles | |
CCB peptide; CCB peptide long form; CCB peptide short form; CgB; CHGB; chromogranin B; chromogranin B (secretogranin 1); Chromogranin B, parathyroid secretory protein; chromogranin-B; GAWK peptide; Glucagonoma peptide; PE-11; SCG1; Scg-1; secretogranin B; secretogranin I; Secretogranin-1; secretogranin-I; SgI | |
Unconjugated | |
Recombinant | |
E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur