missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Chromogranin A (aa 22-162) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP96603
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Chromogranin A (CHGA) is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocine cells. CHGA is a precursor to three biologically active peptides: vasostatin, pancreastatin, and parastatin. These peptides act as autocine or paracrine negative modulators of the neuroendocrine system. CHGA is an excellent marker for carcinoid tumors, pheo-chromocytomas, paragangliomas, and other neuro-endocrine tumors. Coexpression of chromogranin A and neuron specific enolase (NSE) is common in neuroendocrine neoplasms.
Spezifikation
| P10645 | |
| Blocking Assay, Control | |
| 1113 | |
| 100 μL | |
| RUO | |
| Chga | |
| Human | |
| NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| Chromogranin A | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| AL-11; AL26; Beta-granin; betagranin (N-terminal fragment of chromogranin A); catestatin; CgA; CHGA; ChrA; chromofungin; chromogranin A; chromogranin A (parathyroid secretory protein 1); chromogranin A precursor; chromogranin-A; CTNNB; DKFZp686D02253; EA-92; ER-37; ES-43; FLJ25606; FLJ37923; GE-25; GR-44; GV-19; LF-19; LOW QUALITY PROTEIN: chromogranin-A; MGC105435; Pancreastatin; Parastatin; parathyroid secretory protein 1; p-Glu serpinin precursor; pituitary secretory protein I; Serpinin; Serpinin-RRG; SL21; SP-I; SS-18; Vasostatin I; Vasostatin II; Vasostatin-1; Vasostatin-2; WA-8; WE-14 | |
| Unconjugated | |
| Recombinant | |
| E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur