missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CASK (aa 283-421) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP92154
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CASK is a calcium/calmodulin-dependent serine protein kinase which is a MAGUK (membrane-associated guanylate kinase) protein family member. CASK is a scaffold protein and the encoded protein is located at synapses in the brain. CASK associates with FG syndrome 4, mental retardation, microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked mental retardation. CASK functions as a cytoskeletal membrane scaffold that coordinates signal transduction pathways within the cortical cytoskeleton.
Spezifikation
| O14936 | |
| Blocking Assay, Control | |
| 8573 | |
| 100 μL | |
| RUO | |
| Cask | |
| Human | |
| AYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKE | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| CASK | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| CAGH39; calcium/calmodulin dependent serine protein kinase; calcium/calmodulin-dependent serin protein kinase; Calcium/calmodulin-dependent serine protein kinase; calcium/calmodulin-dependent serine protein kinase (MAGUK family); calcium/calmodulin-dependent serine protein kinase membrane-associated guanylate kinase; CAMGUK; CASK; CMG; DXPri1; DXRib1; FGS4; G-protein-coupled receptor GPR34; hCASK; LIN2; LIN-2; MGC7449; MICPCH; mLin-2; MRXSNA; OTTHUMP00000023157; OTTHUMP00000023161; OTTHUMP00000023162; Pals3; peripheral plasma membrane protein CASK; Protein lin-2 homolog; RP23-278L4.1; TNRC8; trinucleotide repeat containing 8 | |
| Unconjugated | |
| Recombinant | |
| E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur