missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human c-Met Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP106648
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
MET (cMET) is a receptor-like tyrosine kinase whose dysregulation has been linked to many types of human malignancies. After activation of the ligand, MET interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, and STAT3. There interactions lead to the activation of signaling cascades including RAS-ERK, PI3, kinase-AKT, and PLCgamma-PKC. MET plays a role in embryonic development including gastrulation, development of muscles and neurons, angiogenesis, and kidney formation. It also plays a role in adults including wound healing, organ regeneration, and tissue remodeling. MET has been linked to cancers including gastric, renal, and breast; therefore, making it a target for cancer therapeutics and diagnostic testing.Spezifikation
P08581 | |
Blocking Assay, Control | |
4233 | |
100 μL | |
RUO | |
MET | |
Human | |
SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
c-Met | |
-20° C, Avoid Freeze/Thaw Cycles | |
AI838057; AUTS9; bHLHe59; CG1705; CG1705-PA; CG1705-PB; cmet; c-met; c-met proto-oncogene; c-Met receptor tyrosine kinase; c-Met/HGF receptor; D249; DFNB97; Dmel\CG1705; Dmel_CG1705; DmMet; EC 2.7.10.1; Hepatocyte growth factor receptor; HGF; HGF receptor; HGF receptor c-Met; HGF/SF receptor; HGFR; HGF-SF receptor; juvenile hormone resistance; met; met proto-oncogene; met proto-oncogene (hepatocyte growth factor receptor); met proto-oncogene tyrosine kinase; MET proto-oncogene, receptor tyrosine kinase; Met/Met1; Met; protein tyrosin kinase; methoprene tolerant; Methoprene-tolerant; Methoprene-tolerant protein; Met-PA; Met-PB; Mett; oncogene MET; Par4; Proto-oncogene c-Met; RCCP2; resistance (1) juvenile H; resistance to juvenile hormone; Rst(1)JH; sc MET; scatter factor receptor; SF receptor; soluble c met; tyrosine-protein kinase Met | |
Unconjugated | |
Recombinant | |
E. coli |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur