missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Apolipoprotein H Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP100507
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.Spezifikation
P02749 | |
Blocking Assay, Control | |
350 | |
100 μL | |
RUO | |
APOH | |
Human | |
ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
Apolipoprotein H | |
-20° C, Avoid Freeze/Thaw Cycles | |
2GPI; activated protein C-binding protein; Anticardiolipin cofactor; APC inhibitor; APOH; Apo-H; Apolipoprotein H; apolipoprotein H (beta-2-glycoprotein I); B2G1; B2GP1; B2GPI; beta(2)GPI; beta-2-glycoprotein 1; Beta-2-glycoprotein I; beta-2-GPI; beta2-GPI; BG | |
Unconjugated | |
Recombinant | |
E. coli |