Abnova™ DDIT3 (Human) Recombinant Protein

Human DDIT3 full-length ORF ( AAH03637.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Marke: Abnova™ H00001649-P01.25ug

Lernen Sie weitere Varianten dieses

Artikelnummer. 16127017

561.00 CHF / 25 Mikrogramm

Quantity

Verfügbar ab: 18-02-2025
Sie sich ein, um den Lagerbestand zu sehen

Add to basket

This item is not returnable. View return policy

Description

Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Specifications

Zugriffsnummer	AAH03637.1
Name	DNA-damage-inducible transcript 3
Qualitätskontrollen	125% SDS-PAGE Stained with Coomassie Blue
Lagerungsbedingungen	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gensymbol	DDIT3
Proteinmarkierung	GST

Gen-ID (Entrez)	1649
Vorbereitungsmethode	Wheat germ expression system
Menge	25 μg
Gen-Alias	CEBPZ, CHOP, CHOP10, GADD153, MGC4154
Spezies	Wheat Germ (in vitro)
Puffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ DDIT3 (Human) Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Special Offers