missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Cysteine/histidine-rich 1 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP2-56486PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human cysteine/histidine-rich 1. Source: E.coli Amino Acid Sequence: ECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFIT The cysteine/histidine-rich 1 Recombinant Protein Antigen is derived from E. coli. The cysteine/histidine-rich 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Spezifikation
| 50626 | |
| Cysteine/histidine-rich 1 Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| CHRP, cysteine and histidine rich 1, cysteine and histidine-rich protein 1, cysteine/histidine-rich 1, KIAA0496cysteine and histidine rich protein, MGC13010 | |
| Unmarkiert | |
| 100 μl | |
| E. coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| CYHR1 | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49974. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Nur für Forschungszwecke.