missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ calmodulin-lysine N-methyltransferase Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Marke: Novus Biologicals™ NBP2-57496PEP
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human calmodulin-lysine N-methyltransferase. Source: E.coli Amino Acid Sequence: SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG The calmodulin-lysine N-methyltransferase Recombinant Protein Antigen is derived from E. coli. The calmodulin-lysine N-methyltransferase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Spezifikation
| 79823 | |
| calmodulin-lysine N-methyltransferase Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| C2orf34, calmodulin methyltransferase, calmodulin-lysine N-methyltransferase, Cam, CaM KMT, chromosome 2 open reading frame 34, CLNMTFLJ23451, EC 2.1.1.60, KMT | |
| Unmarkiert | |
| 100 μl | |
| E. coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| CAMKMT | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53063. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Nur für Forschungszwecke.